Sequence
9077826 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>9077826
MAENPGLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFINPSIPITFLRNVTWVIVNLCRNKDPPPPMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTSRPRWSSTAMSCPTSQTS
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| D3ZU98 |
Kpna3 |
Protein Kpna3 |
Disordered Regions
75% of predictor's agree:
| Start |
End |
| 1 |
40 |
| 42 |
64 |
| 322 |
328 |
| 331 |
333 |
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
68 |
| VSL2b |
1 |
87 |
| PrDOS |
1 |
75 |
| PV2 |
1 |
68 |
| IUPred-S |
1 |
36 |
| IUPred-L |
1 |
54 |
| Espritz-N |
1 |
29 |
| Espritz-X |
1 |
61 |
| IUPred-S |
45 |
62 |
| Espritz-N |
48 |
65 |
| IUPred-L |
56 |
64 |
| PV2 |
70 |
70 |
| PrDOS |
77 |
78 |
| VLXT |
80 |
108 |
| PrDOS |
80 |
81 |
| VSL2b |
96 |
108 |
| PV2 |
96 |
104 |
| IUPred-L |
98 |
98 |
| Espritz-N |
98 |
108 |
| PV2 |
107 |
107 |
| PrDOS |
122 |
128 |
| VLXT |
145 |
152 |
| VSL2b |
148 |
151 |
| PV2 |
151 |
151 |
| VSL2b |
231 |
238 |
| PV2 |
231 |
238 |
| VLXT |
233 |
243 |
| PV2 |
263 |
263 |
| VLXT |
310 |
324 |
| Espritz-X |
314 |
333 |
| VSL2b |
315 |
333 |
| PV2 |
315 |
333 |
| PrDOS |
319 |
333 |
| IUPred-S |
319 |
320 |
| Espritz-N |
319 |
333 |
| IUPred-S |
322 |
333 |
| IUPred-L |
322 |
329 |
| IUPred-L |
331 |
333 |
| VLXT |
333 |
333 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| ARM repeat |
48371 |
1.03e-79 |
Armadillo repeat |
48372 |
0.000000211 |
9-316 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Family |
CL0020 |
PF01749.15 |
IBB |
Importin beta binding domain |
3.2e-26 |
91.3 |
3 |
94 |
| Repeat |
CL0020 |
PF00514.18 |
Arm |
Armadillo/beta-catenin-like repeat |
0.0000000000051 |
45.1 |
103 |
144 |
| Repeat |
CL0020 |
PF00514.18 |
Arm |
Armadillo/beta-catenin-like repeat |
0.00000000000019 |
49.6 |
146 |
185 |
| Repeat |
CL0020 |
PF00514.18 |
Arm |
Armadillo/beta-catenin-like repeat |
0.0000052 |
26 |
188 |
229 |
| Repeat |
CL0020 |
PF00514.18 |
Arm |
Armadillo/beta-catenin-like repeat |
0.0000069 |
25.6 |
232 |
271 |
| Repeat |
CL0020 |
PF00514.18 |
Arm |
Armadillo/beta-catenin-like repeat |
0.000000000089 |
41.2 |
273 |
313 |
Post Translational Modification Sites
No weak SCOP hits found.