Sequence
3382308 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3382308
MDQMLSPNFSIPSIGTPLHQMEADQQIVANPVYHPPAVSQPDSLMPAPGSSSVQHQQQQQQSDASGGSGLFGHEPSLPLAHKQMQSYQPSASYQQQQQQQQLQSQAPGGGGSTPQSMMQPQTPQSMMAHMMPMSERSVGGSGAGGGGDALSNIHQTMGPSTPMTPATPGSADPGIVPQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPELFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFKKQS
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| P20227 |
Tbp |
Transcription initiation factor TFIID TBP subunit |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
71 |
| VSL2b |
1 |
174 |
| PrDOS |
1 |
16 |
| PV2 |
1 |
178 |
| IUPred-S |
1 |
9 |
| IUPred-L |
1 |
177 |
| Espritz-N |
1 |
176 |
| Espritz-X |
1 |
147 |
| IUPred-S |
16 |
18 |
| PrDOS |
20 |
174 |
| IUPred-S |
20 |
20 |
| Espritz-D |
20 |
20 |
| IUPred-S |
22 |
23 |
| Espritz-D |
22 |
73 |
| IUPred-S |
25 |
172 |
| VLXT |
82 |
179 |
| Espritz-N |
201 |
208 |
| PV2 |
223 |
223 |
| VSL2b |
237 |
245 |
| PV2 |
237 |
238 |
| VLXT |
238 |
253 |
| Espritz-N |
239 |
241 |
| PV2 |
243 |
244 |
| PrDOS |
292 |
300 |
| PV2 |
300 |
300 |
| PV2 |
306 |
307 |
| VSL2b |
348 |
353 |
| PV2 |
348 |
353 |
| Espritz-X |
349 |
353 |
| PrDOS |
350 |
353 |
| IUPred-S |
350 |
353 |
| VLXT |
352 |
353 |
| Espritz-N |
352 |
353 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| TATA-box binding protein-like |
55945 |
7.38e-35 |
TATA-box binding protein (TBP), C-terminal domain |
55946 |
0.00000412 |
174-268 |
| TATA-box binding protein-like |
55945 |
2.67e-30 |
TATA-box binding protein (TBP), C-terminal domain |
55946 |
0.0000134 |
261-350 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
CL0407 |
PF00352.16 |
TBP |
Transcription factor TFIID (or TATA-binding protein, TBP) |
7.700000000000001e-32 |
108.5 |
175 |
259 |
| Domain |
CL0407 |
PF00352.16 |
TBP |
Transcription factor TFIID (or TATA-binding protein, TBP) |
4.2000000000000005e-33 |
112.5 |
264 |
350 |
Post Translational Modification Sites
No weak SCOP hits found.