Sequence
3354692 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3354692
MSILAYNGGCVVAMRGKDCVAIATDHRFGIQAQTISTDFKKVFHIGPRMFLGLTGLQTDILTVRDRLMFRKNLYETRENREMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLDPKTMEPFICNMDLIGCPNAPDDFVVAGTCAEQLYGMCETLWKPDLEPDQLFEVIAQSIVNAFDRDAMSGWGATVYIIEKDKITERTLKTRMD
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| A0API2 |
GD20828 |
Proteasome subunit beta type |
| B3P1V0 |
GG17403 |
Proteasome subunit beta type |
| B4HKX9 |
GM26292 |
Proteasome subunit beta type |
| B4PTY8 |
GE24806 |
Proteasome subunit beta type |
| C0MJU2 |
CG11981 |
Proteasome subunit beta type |
| Q9XYN7 |
Prosbeta3 |
20S proteasome subunit beta-3 |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VSL2b |
1 |
3 |
| PrDOS |
1 |
6 |
| PV2 |
1 |
6 |
| IUPred-S |
1 |
2 |
| Espritz-N |
1 |
3 |
| Espritz-X |
1 |
4 |
| VLXT |
71 |
86 |
| VSL2b |
76 |
86 |
| PV2 |
77 |
79 |
| PV2 |
81 |
82 |
| PrDOS |
134 |
136 |
| PrDOS |
142 |
157 |
| VSL2b |
197 |
205 |
| PV2 |
197 |
205 |
| VLXT |
198 |
198 |
| Espritz-N |
199 |
205 |
| IUPred-S |
200 |
205 |
| Espritz-X |
200 |
205 |
| PrDOS |
201 |
205 |
| IUPred-L |
201 |
201 |
| VLXT |
202 |
202 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| N-terminal nucleophile aminohydrolases (Ntn hydrolases) |
56235 |
2.24e-52 |
Proteasome subunits |
56251 |
0.000000119 |
4-205 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
CL0052 |
PF00227.21 |
Proteasome |
Proteasome subunit |
9.9e-41 |
139.1 |
5 |
190 |
Post Translational Modification Sites
No weak SCOP hits found.