Sequence
3325116 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3325116
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVAARQGQETAVAPSLVAPALSKPKKPLGSGSAAPQRPIATQRTTAAPKAGPGMVRKNPGMGNGDDEAAELMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| Q66HR2 |
Mapre1 |
End-binding protein 1 |
Disordered Regions
75% of predictor's agree:
| Start |
End |
| 130 |
130 |
| 140 |
140 |
| 149 |
194 |
| 256 |
268 |
By predictor:
| Predictor |
Start |
End |
| VSL2b |
1 |
15 |
| PrDOS |
1 |
14 |
| PV2 |
1 |
9 |
| IUPred-S |
1 |
5 |
| Espritz-N |
1 |
16 |
| Espritz-X |
1 |
12 |
| PV2 |
38 |
38 |
| Espritz-N |
119 |
134 |
| PrDOS |
125 |
205 |
| PV2 |
126 |
197 |
| VLXT |
128 |
202 |
| VSL2b |
130 |
196 |
| IUPred-S |
130 |
131 |
| IUPred-L |
130 |
130 |
| Espritz-X |
132 |
136 |
| Espritz-N |
137 |
191 |
| IUPred-S |
140 |
193 |
| IUPred-L |
140 |
141 |
| Espritz-X |
144 |
196 |
| IUPred-L |
149 |
194 |
| Espritz-N |
211 |
213 |
| VLXT |
227 |
240 |
| IUPred-L |
229 |
230 |
| VSL2b |
232 |
232 |
| PV2 |
232 |
232 |
| Espritz-N |
232 |
236 |
| IUPred-L |
233 |
233 |
| PV2 |
236 |
238 |
| IUPred-L |
239 |
241 |
| PV2 |
251 |
251 |
| Espritz-N |
251 |
268 |
| VLXT |
252 |
268 |
| PrDOS |
253 |
268 |
| IUPred-S |
253 |
268 |
| IUPred-L |
253 |
268 |
| PV2 |
254 |
268 |
| VSL2b |
256 |
268 |
| Espritz-X |
256 |
268 |
| Espritz-D |
256 |
268 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| Calponin-homology domain, CH-domain |
47576 |
1.83e-51 |
Calponin-homology domain, CH-domain |
47577 |
0.00000016 |
1-130 |
| EB1 dimerisation domain-like |
140612 |
5.62e-21 |
EB1 dimerisation domain-like |
140613 |
0.0000301 |
194-254 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Pfam-B |
No Clan |
PB007420 |
|
|
0.00000059 |
28.4 |
14 |
91 |
| Domain |
CL0188 |
PF00307.26 |
CH |
Calponin homology (CH) domain |
0.000000000019 |
43.9 |
17 |
116 |
| Pfam-B |
No Clan |
PB001461 |
|
|
0.000000032 |
32.1 |
143 |
256 |
| Family |
No Clan |
PF03271.12 |
EB1 |
EB1-like C-terminal motif |
1.5e-16 |
60.1 |
209 |
248 |
Post Translational Modification Sites
| Locus |
Amino Acid |
Disordered |
PTM Type |
Sequence Context |
| 83 |
K |
No |
ACETYLATION |
KILQAGFkRMGVDKI |
| 95 |
K |
No |
ACETYLATION |
DKIIPVDkLVKGKFQ |