Results for 3252369

PNG SVG

Sequence

3252369 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>3252369
GEVQRSIGRWRARRLRARLRREGPRLKPKADQSGGTRVAAAETRRRTPDPARRSPSLAMEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
F6VW30 Ywhaq 14-3-3 protein theta

Disordered Regions

75% of predictor's agree:

Start End
1 1
3 4
13 15
17 60
294 303

By predictor:

Predictor Start End
VLXT 1 1
VSL2b 1 86
PrDOS 1 62
PV2 1 81
IUPred-S 1 9
Espritz-N 1 8
Espritz-X 1 61
Espritz-D 1 47
VLXT 3 4
IUPred-L 3 3
VLXT 10 64
IUPred-L 13 14
IUPred-L 17 65
IUPred-S 18 65
Espritz-N 19 56
IUPred-S 70 70
VLXT 79 110
IUPred-L 81 82
PV2 83 83
PV2 85 86
PrDOS 86 94
VSL2b 88 99
IUPred-L 88 89
Espritz-N 89 92
PV2 90 99
VLXT 112 113
PV2 115 115
VLXT 118 127
IUPred-L 121 122
PrDOS 122 138
VSL2b 123 135
PV2 123 134
VLXT 130 151
VSL2b 140 146
PV2 140 141
PV2 143 146
PrDOS 192 215
VLXT 197 202
VSL2b 198 204
PV2 199 206
PV2 208 208
PV2 210 211
IUPred-L 211 212
VSL2b 213 220
PV2 213 216
Espritz-N 218 220
PV2 243 244
PV2 246 246
VLXT 252 252
VLXT 254 255
VSL2b 264 269
PV2 265 266
PrDOS 268 270
PV2 269 269
PV2 286 303
Espritz-X 287 303
PrDOS 288 303
VSL2b 289 303
Espritz-N 289 303
VLXT 290 303
IUPred-S 294 303
IUPred-L 294 303

SCOP Domain Regions

Hits with strong support:

Superfamily Name SFam ID SFam E-value Family Name Fam ID Fam E-value Region
14-3-3 protein 48445 1.1e-104 14-3-3 protein 48446 0.00000000541 59-289

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Domain No Clan PF00244.15 14-3-3 14-3-3 protein 5.700000000000001e-111 369.2 61 294

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 3252369


comments powered by Disqus