Results for 3240445

PNG SVG

Sequence

3240445 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>3240445
XIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIVFVTSHEKRSPLRTPCDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
F6Q3W0 Wdr5 WD repeat-containing protein 5

Disordered Regions

75% of predictor's agree:

No agreed upon disordered regions found.

By predictor:

Predictor Start End
VSL2b 1 3
PrDOS 1 4
IUPred-S 1 4
VSL2b 30 36
VSL2b 103 105
PrDOS 145 161
Espritz-N 147 162
VSL2b 149 162
IUPred-S 154 156
IUPred-L 154 154
VSL2b 277 281
IUPred-S 277 281
Espritz-X 278 281
PrDOS 279 281

SCOP Domain Regions

Hits with strong support:

Superfamily Name SFam ID SFam E-value Family Name Fam ID Fam E-value Region
WD40 repeat-like 50978 4.58e-86 WD40-repeat 50979 0.0000152 2-278

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Repeat CL0186 PF00400.27 WD40 WD domain, G-beta repeat 0.000000000049 42 8 46
Repeat CL0186 PF00400.27 WD40 WD domain, G-beta repeat 0.00000000000077 47.7 50 88
Repeat CL0186 PF00400.27 WD40 WD domain, G-beta repeat 0.000000000016 43.6 92 130
Repeat CL0186 PF00400.27 WD40 WD domain, G-beta repeat 0.0000093 25.3 156 189
Repeat CL0186 PF00400.27 WD40 WD domain, G-beta repeat 0.00000064 29 193 234
Repeat CL0186 PF00400.27 WD40 WD domain, G-beta repeat 0.00000022 30.4 238 278

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 3240445


comments powered by Disqus