Sequence
3238122 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3238122
MKPPISIQASEFDSSDEEPVDEEQTPIQISWLPLSRVNCSQFLGLCALPGCKFKDVRRNIQKDTEELKSYGIQDVFVFCTRGELSKYRVPNLLDLYQQYGIVTHHHPIPDGGTPDIGSCWEIMEELATCLKNNRKTLIHCYGGLGRSCLAACLLLYLSDSISPQQAIDSLRDVRGSGAIQTIKQYNYLHEFRDKLAAYLSSRDSLSRSVSR
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| Q810P3 |
Cdkn3 |
Kinase-associated phosphatase |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
29 |
| VSL2b |
1 |
26 |
| PrDOS |
1 |
31 |
| PV2 |
1 |
30 |
| IUPred-S |
1 |
26 |
| Espritz-N |
1 |
25 |
| Espritz-X |
1 |
25 |
| Espritz-D |
1 |
11 |
| IUPred-L |
7 |
20 |
| IUPred-L |
23 |
23 |
| PrDOS |
34 |
39 |
| VLXT |
55 |
65 |
| VSL2b |
61 |
67 |
| Espritz-N |
105 |
115 |
| VSL2b |
107 |
113 |
| PV2 |
107 |
107 |
| PV2 |
110 |
112 |
| VLXT |
117 |
119 |
| VSL2b |
163 |
168 |
| VLXT |
169 |
171 |
| Espritz-X |
196 |
211 |
| PrDOS |
197 |
211 |
| VSL2b |
199 |
211 |
| PV2 |
199 |
211 |
| VLXT |
200 |
211 |
| Espritz-N |
202 |
211 |
| IUPred-S |
207 |
211 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| (Phosphotyrosine protein) phosphatases II |
52799 |
4.35e-44 |
Dual specificity phosphatase-like |
52800 |
0.000000128 |
26-194 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Family |
CL0031 |
PF05706.7 |
CDKN3 |
Cyclin-dependent kinase inhibitor 3 (CDKN3) |
3.0999999999999996e-116 |
384.6 |
1 |
167 |
Post Translational Modification Sites
No weak SCOP hits found.