Sequence
3237421 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3237421
MLPLSLLKTAQNHPMDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVR
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| D3YTP8 |
Lsm4 |
U6 snRNA-associated Sm-like protein LSm4 |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
10 |
| VSL2b |
1 |
7 |
| PrDOS |
1 |
15 |
| PV2 |
1 |
12 |
| IUPred-S |
1 |
7 |
| Espritz-N |
1 |
19 |
| Espritz-X |
1 |
11 |
| Espritz-D |
1 |
47 |
| PrDOS |
42 |
43 |
| VSL2b |
44 |
47 |
| PrDOS |
44 |
47 |
| PV2 |
44 |
47 |
| IUPred-S |
45 |
47 |
| Espritz-N |
45 |
47 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| Sm-like ribonucleoproteins |
50182 |
0.0000003 |
|
|
|
3-46 |
Hits with weaker support:
No weak SCOP hits found.
Post Translational Modification Sites
No weak SCOP hits found.