Results for 32355334

PNG SVG

Sequence

32355334 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>32355334
MDKSDLVQKAKLAEQAERYDDMAASMKAVTEGGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIEAELQEICNDVLGLLEKYLIPNASQAESKVFYLKMKGDYYRYLSEVASGDSKRTTVENSQKAYQDAFEISKKEMQPTHPIRLGLALNFSVFYYEILNTPEQACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLT

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
E9QJ96 ywhaba 14-3-3 protein beta/alpha-A

Disordered Regions

75% of predictor's agree:

Start End
2 3
70 74

By predictor:

Predictor Start End
VLXT 1 90
VSL2b 1 42
PrDOS 1 10
PV2 1 26
IUPred-S 1 9
Espritz-N 1 6
Espritz-X 1 13
Espritz-D 2 3
PrDOS 27 37
PV2 28 28
PV2 30 30
IUPred-L 30 31
PV2 32 32
PV2 34 34
PV2 36 38
VSL2b 53 87
PV2 56 88
PrDOS 63 80
IUPred-L 65 67
Espritz-N 69 74
IUPred-L 70 81
IUPred-S 72 72
IUPred-S 76 76
PrDOS 111 112
PV2 131 161
VSL2b 133 148
PrDOS 133 159
Espritz-N 136 136
VLXT 137 144
IUPred-L 140 141
IUPred-L 143 143
IUPred-L 153 154
VSL2b 154 161
Espritz-N 161 161
PV2 186 187
VLXT 192 198
VSL2b 206 212
PV2 207 207
PrDOS 210 213
PV2 211 212
VSL2b 222 226
PV2 222 226
PrDOS 223 226
IUPred-S 223 226
Espritz-N 224 226
Espritz-X 224 226
VLXT 226 226

SCOP Domain Regions

Hits with strong support:

Superfamily Name SFam ID SFam E-value Family Name Fam ID Fam E-value Region
14-3-3 protein 48445 2.49e-101 14-3-3 protein 48446 0.00000000369 1-226

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Domain No Clan PF00244.15 14-3-3 14-3-3 protein 3.0999999999999996e-107 357 3 226

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 32355334


comments powered by Disqus