Sequence
32355334 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>32355334
MDKSDLVQKAKLAEQAERYDDMAASMKAVTEGGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIEAELQEICNDVLGLLEKYLIPNASQAESKVFYLKMKGDYYRYLSEVASGDSKRTTVENSQKAYQDAFEISKKEMQPTHPIRLGLALNFSVFYYEILNTPEQACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLT
View in source genome browser
UniProt Gene descriptions
UniProt |
Gene Name |
Gene Description |
E9QJ96 |
ywhaba |
14-3-3 protein beta/alpha-A |
Disordered Regions
75% of predictor's agree:
By predictor:
Predictor |
Start |
End |
VLXT |
1 |
90 |
VSL2b |
1 |
42 |
PrDOS |
1 |
10 |
PV2 |
1 |
26 |
IUPred-S |
1 |
9 |
Espritz-N |
1 |
6 |
Espritz-X |
1 |
13 |
Espritz-D |
2 |
3 |
PrDOS |
27 |
37 |
PV2 |
28 |
28 |
PV2 |
30 |
30 |
IUPred-L |
30 |
31 |
PV2 |
32 |
32 |
PV2 |
34 |
34 |
PV2 |
36 |
38 |
VSL2b |
53 |
87 |
PV2 |
56 |
88 |
PrDOS |
63 |
80 |
IUPred-L |
65 |
67 |
Espritz-N |
69 |
74 |
IUPred-L |
70 |
81 |
IUPred-S |
72 |
72 |
IUPred-S |
76 |
76 |
PrDOS |
111 |
112 |
PV2 |
131 |
161 |
VSL2b |
133 |
148 |
PrDOS |
133 |
159 |
Espritz-N |
136 |
136 |
VLXT |
137 |
144 |
IUPred-L |
140 |
141 |
IUPred-L |
143 |
143 |
IUPred-L |
153 |
154 |
VSL2b |
154 |
161 |
Espritz-N |
161 |
161 |
PV2 |
186 |
187 |
VLXT |
192 |
198 |
VSL2b |
206 |
212 |
PV2 |
207 |
207 |
PrDOS |
210 |
213 |
PV2 |
211 |
212 |
VSL2b |
222 |
226 |
PV2 |
222 |
226 |
PrDOS |
223 |
226 |
IUPred-S |
223 |
226 |
Espritz-N |
224 |
226 |
Espritz-X |
224 |
226 |
VLXT |
226 |
226 |
SCOP Domain Regions
Hits with strong support:
Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
14-3-3 protein |
48445 |
2.49e-101 |
14-3-3 protein |
48446 |
0.00000000369 |
1-226 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
Domain |
No Clan |
PF00244.15 |
14-3-3 |
14-3-3 protein |
3.0999999999999996e-107 |
357 |
3 |
226 |
Post Translational Modification Sites
No weak SCOP hits found.