Results for 32354980

PNG SVG

Sequence

32354980 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>32354980
MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQVMMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEFGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYL

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
E9QI69 cops2 COP9 signalosome complex subunit 2

Disordered Regions

75% of predictor's agree:

Start End
1 31
185 185

By predictor:

Predictor Start End
VLXT 1 25
VSL2b 1 64
PrDOS 1 41
PV2 1 53
IUPred-S 1 41
Espritz-N 1 31
Espritz-X 1 30
Espritz-D 1 42
IUPred-L 3 4
IUPred-L 15 25
IUPred-L 27 38
Espritz-X 41 43
IUPred-S 43 43
Espritz-N 44 46
PV2 58 59
VSL2b 108 109
VSL2b 164 171
PV2 165 165
PV2 170 173
PrDOS 178 193
PV2 178 178
VSL2b 180 193
PV2 180 193
Espritz-N 183 188
IUPred-L 184 185
VLXT 185 185
IUPred-S 185 186
VSL2b 211 217
VLXT 242 250
VSL2b 249 255
PV2 251 253
PV2 255 257
VSL2b 266 282
PV2 268 282
Espritz-X 268 282
VLXT 271 276
PrDOS 271 275
IUPred-S 277 282

SCOP Domain Regions

Hits with strong support:

No strong SCOP hits found.

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Pfam-B No Clan PB001935 4.1000000000000003e-78 264.3 1 281
Pfam-B No Clan PB006466 9.999999999999999e-55 182.7 1 89
Pfam-B No Clan PB000935 0.00034 19.1 198 282

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 32354980


comments powered by Disqus