Sequence
32200799 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>32200799
MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVRSPHIISVTSIDIFKYRNIHTFKTLDAWCYDLLQLSLSVSFFICRNKSNILCHG
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| A2BFY8 |
h2afz |
Histone H2A |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
22 |
| VSL2b |
1 |
30 |
| PrDOS |
1 |
25 |
| PV2 |
1 |
43 |
| IUPred-S |
1 |
44 |
| IUPred-L |
1 |
6 |
| Espritz-N |
1 |
28 |
| Espritz-X |
1 |
23 |
| Espritz-D |
3 |
3 |
| Espritz-D |
9 |
41 |
| IUPred-L |
11 |
14 |
| VSL2b |
36 |
45 |
| PrDOS |
38 |
47 |
| IUPred-L |
39 |
39 |
| Espritz-X |
39 |
43 |
| Espritz-N |
40 |
45 |
| VLXT |
49 |
67 |
| PV2 |
91 |
91 |
| PrDOS |
112 |
120 |
| VSL2b |
116 |
120 |
| PV2 |
116 |
120 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| Histone-fold |
47113 |
5.86e-23 |
|
|
|
3-66 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
CL0012 |
PF00125.19 |
Histone |
Core histone H2A/H2B/H3/H4 |
0.0000000013 |
37.9 |
20 |
68 |
Post Translational Modification Sites
No weak SCOP hits found.