Sequence
3215091 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3215091
MSWRRAASVGRRLVASGRILAGRRGAAGAAGSGMGNSTSSFWGKSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQDALHKMTGERTVPRIFVNGRFIGGAADTHRLHKEGKLLPLVHQCYLKKKQEERH
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| A2A5W4 |
Glrx2 |
Glutaredoxin 2 (Thioltransferase) |
| Q923X4 |
Glrx2 |
Glutaredoxin-2, mitochondrial |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
5 |
| VSL2b |
1 |
54 |
| PrDOS |
1 |
51 |
| PV2 |
1 |
54 |
| IUPred-S |
1 |
7 |
| Espritz-N |
1 |
49 |
| Espritz-X |
1 |
40 |
| VLXT |
7 |
43 |
| IUPred-S |
31 |
32 |
| IUPred-L |
38 |
38 |
| IUPred-S |
40 |
40 |
| IUPred-L |
41 |
41 |
| IUPred-L |
45 |
45 |
| Espritz-N |
110 |
111 |
| VSL2b |
134 |
137 |
| PV2 |
136 |
137 |
| PV2 |
141 |
156 |
| PrDOS |
146 |
156 |
| VSL2b |
149 |
156 |
| Espritz-X |
149 |
156 |
| Espritz-N |
150 |
156 |
| IUPred-S |
151 |
156 |
| VLXT |
152 |
156 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| Thioredoxin-like |
52833 |
2.27e-29 |
|
|
|
50-145 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
CL0172 |
PF00462.19 |
Glutaredoxin |
Glutaredoxin |
3.3e-19 |
68.6 |
62 |
124 |
Post Translational Modification Sites
| Locus |
Amino Acid |
Disordered |
PTM Type |
Sequence Context |
| 56 |
T |
No |
PHOSPHORYLATION |
PVNQIQEtISNNCVV |