Sequence
3211921 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3211921
MDAFKGGMSLERLPEGLRPPPPPPHDMGPSFHLARAADPREPLENSASESSDADLPDKERGGEAKGPEDGGAGSAGCGGGAEDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| P70314 |
Pitx1 |
Pituitary OTX-related factor |
| Q3UQH0 |
Pitx1 |
Paired-like homeodomain transcription factor 1, isoform CRA_a |
Disordered Regions
75% of predictor's agree:
| Start |
End |
| 1 |
99 |
| 111 |
112 |
| 149 |
150 |
| 226 |
242 |
| 246 |
246 |
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
99 |
| VSL2b |
1 |
119 |
| PrDOS |
1 |
98 |
| PV2 |
1 |
118 |
| IUPred-S |
1 |
104 |
| IUPred-L |
1 |
114 |
| Espritz-N |
1 |
123 |
| Espritz-X |
1 |
113 |
| Espritz-D |
1 |
77 |
| IUPred-S |
108 |
109 |
| VLXT |
111 |
112 |
| IUPred-L |
120 |
122 |
| IUPred-L |
125 |
125 |
| PV2 |
126 |
131 |
| Espritz-N |
127 |
131 |
| VLXT |
132 |
155 |
| PV2 |
133 |
133 |
| PrDOS |
139 |
286 |
| PV2 |
140 |
161 |
| IUPred-L |
140 |
142 |
| VSL2b |
145 |
150 |
| Espritz-N |
145 |
153 |
| IUPred-L |
148 |
150 |
| IUPred-L |
156 |
156 |
| PV2 |
164 |
165 |
| VSL2b |
191 |
315 |
| Espritz-N |
192 |
196 |
| PV2 |
193 |
194 |
| PV2 |
196 |
278 |
| Espritz-N |
207 |
274 |
| VLXT |
213 |
279 |
| IUPred-L |
226 |
242 |
| IUPred-S |
227 |
239 |
| IUPred-S |
241 |
242 |
| IUPred-L |
245 |
246 |
| IUPred-S |
246 |
247 |
| IUPred-L |
249 |
249 |
| PV2 |
283 |
290 |
| PrDOS |
291 |
315 |
| Espritz-N |
291 |
315 |
| PV2 |
295 |
315 |
| Espritz-X |
297 |
315 |
| IUPred-S |
309 |
315 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| Homeodomain-like |
46689 |
3.46e-26 |
Homeodomain |
46690 |
0.0000642 |
79-150 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
CL0123 |
PF00046.24 |
Homeobox |
Homeobox domain |
3.7000000000000005e-22 |
77.6 |
91 |
147 |
| Domain |
No Clan |
PF03826.12 |
|
|
0.0000000088 |
34.5 |
276 |
296 |
Post Translational Modification Sites
No weak SCOP hits found.