Results for 32069987

PNG SVG

Sequence

32069987 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>32069987
MDEVTAVVKIEKDVGGNNGGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTAAQLSQGANGWQIIS

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
E9Q2V3 Sp1 Transcription factor Sp1

Disordered Regions

75% of predictor's agree:

Start End
1 97
99 99
101 101
106 106

By predictor:

Predictor Start End
VLXT 1 8
VSL2b 1 106
PrDOS 1 57
PV2 1 106
IUPred-S 1 10
IUPred-L 1 97
Espritz-N 1 58
Espritz-X 1 106
Espritz-D 1 106
IUPred-S 12 12
IUPred-S 15 94
VLXT 22 93
Espritz-N 62 106
PrDOS 65 92
PrDOS 93 106
IUPred-S 99 106
IUPred-L 99 99
IUPred-L 101 101
IUPred-L 106 106

SCOP Domain Regions

Hits with strong support:

No strong SCOP hits found.

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

No Pfam hits found.

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 32069987


comments powered by Disqus