Results for 32069987
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>32069987
MDEVTAVVKIEKDVGGNNGGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTAAQLSQGANGWQIIS
UniProt Gene descriptions
UniProt | Gene Name | Gene Description |
---|---|---|
E9Q2V3 | Sp1 | Transcription factor Sp1 |
Disordered Regions
75% of predictor's agree:
Start | End |
---|---|
1 | 97 |
99 | 99 |
101 | 101 |
106 | 106 |
By predictor:
Predictor | Start | End |
---|---|---|
VLXT | 1 | 8 |
VSL2b | 1 | 106 |
PrDOS | 1 | 57 |
PV2 | 1 | 106 |
IUPred-S | 1 | 10 |
IUPred-L | 1 | 97 |
Espritz-N | 1 | 58 |
Espritz-X | 1 | 106 |
Espritz-D | 1 | 106 |
IUPred-S | 12 | 12 |
IUPred-S | 15 | 94 |
VLXT | 22 | 93 |
Espritz-N | 62 | 106 |
PrDOS | 65 | 92 |
PrDOS | 93 | 106 |
IUPred-S | 99 | 106 |
IUPred-L | 99 | 99 |
IUPred-L | 101 | 101 |
IUPred-L | 106 | 106 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.