Results for 3187187
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3187187
MRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC
UniProt Gene descriptions
| UniProt | Gene Name | Gene Description |
|---|---|---|
| Q5JU15 | GSTO2 | Glutathione S-transferase omega-2 |
Disordered Regions
75% of predictor's agree:
No agreed upon disordered regions found.
By predictor:
| Predictor | Start | End |
|---|---|---|
| VSL2b | 1 | 5 |
| PrDOS | 1 | 4 |
| PV2 | 1 | 5 |
| IUPred-S | 1 | 4 |
| Espritz-N | 1 | 1 |
| Espritz-X | 1 | 4 |
| VLXT | 13 | 23 |
| PrDOS | 107 | 112 |
| VLXT | 119 | 127 |
| PV2 | 159 | 159 |
| PV2 | 169 | 170 |
| PV2 | 174 | 174 |
| PV2 | 179 | 179 |
| PV2 | 181 | 182 |
| PV2 | 208 | 209 |
| VSL2b | 212 | 215 |
| PrDOS | 212 | 213 |
| PV2 | 212 | 215 |
| PrDOS | 214 | 215 |
| IUPred-S | 214 | 215 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name | SFam ID | SFam E-value | Family Name | Fam ID | Fam E-value | Region |
|---|---|---|---|---|---|---|
| Thioredoxin-like | 52833 | 3.29e-22 | Glutathione S-transferase (GST), N-terminal domain | 52862 | 0.0000854 | 2-94 |
| GST C-terminal domain-like | 47616 | 9.41e-26 | Glutathione S-transferase (GST), C-terminal domain | 47617 | 0.0000128 | 75-209 |
Hits with weaker support:
No weak SCOP hits found.