Results for 3186763
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3186763
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVIT
UniProt Gene descriptions
UniProt | Gene Name | Gene Description |
---|---|---|
B0QYX2 | PPARA | Peroxisome proliferator-activated receptor alpha |
Disordered Regions
75% of predictor's agree:
Start | End |
---|---|
1 | 17 |
19 | 20 |
41 | 42 |
64 | 69 |
By predictor:
Predictor | Start | End |
---|---|---|
VLXT | 1 | 44 |
VSL2b | 1 | 69 |
PrDOS | 1 | 20 |
PV2 | 1 | 32 |
IUPred-S | 1 | 32 |
Espritz-N | 1 | 8 |
Espritz-X | 1 | 19 |
Espritz-D | 1 | 69 |
IUPred-L | 2 | 2 |
IUPred-L | 4 | 16 |
IUPred-L | 19 | 42 |
IUPred-S | 34 | 41 |
PrDOS | 39 | 69 |
PV2 | 41 | 41 |
Espritz-N | 41 | 48 |
IUPred-S | 44 | 46 |
PV2 | 45 | 46 |
PV2 | 48 | 48 |
Espritz-N | 60 | 69 |
PV2 | 62 | 69 |
Espritz-X | 62 | 69 |
IUPred-S | 63 | 69 |
VLXT | 64 | 67 |
IUPred-L | 68 | 69 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.