Results for 3186763

PNG SVG

Sequence

3186763 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>3186763
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVIT

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
B0QYX2 PPARA Peroxisome proliferator-activated receptor alpha

Disordered Regions

75% of predictor's agree:

Start End
1 17
19 20
41 42
64 69

By predictor:

Predictor Start End
VLXT 1 44
VSL2b 1 69
PrDOS 1 20
PV2 1 32
IUPred-S 1 32
Espritz-N 1 8
Espritz-X 1 19
Espritz-D 1 69
IUPred-L 2 2
IUPred-L 4 16
IUPred-L 19 42
IUPred-S 34 41
PrDOS 39 69
PV2 41 41
Espritz-N 41 48
IUPred-S 44 46
PV2 45 46
PV2 48 48
Espritz-N 60 69
PV2 62 69
Espritz-X 62 69
IUPred-S 63 69
VLXT 64 67
IUPred-L 68 69

SCOP Domain Regions

Hits with strong support:

No strong SCOP hits found.

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

No Pfam hits found.

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 3186763


comments powered by Disqus