Sequence
3185232 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3185232
MNKLFSFWKRKNETRSQGYNLREKDLKKLHRAASVGDLKKLKEYLQIKKYDVNMQDKKYSVVQSSRWLLSYTTPLNDFIRTPLHLACANGHTDVVLFLIEQQCK
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| C9J2M7 |
ANKRD7 |
Ankyrin repeat domain-containing protein 7 |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VSL2b |
1 |
41 |
| PrDOS |
1 |
24 |
| PV2 |
1 |
33 |
| IUPred-S |
1 |
9 |
| Espritz-N |
1 |
2 |
| Espritz-X |
1 |
20 |
| Espritz-D |
3 |
77 |
| VLXT |
12 |
36 |
| IUPred-S |
19 |
19 |
| IUPred-L |
19 |
20 |
| PV2 |
35 |
39 |
| VSL2b |
55 |
59 |
| PrDOS |
55 |
78 |
| PrDOS |
100 |
104 |
| VSL2b |
102 |
104 |
| PV2 |
102 |
104 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| Ankyrin repeat |
48403 |
0.000000000115 |
|
|
|
17-102 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Family |
CL0465 |
PF12796.2 |
Ank_2 |
Ankyrin repeats (3 copies) |
0.00000027 |
30.8 |
28 |
104 |
Post Translational Modification Sites
No weak SCOP hits found.