Sequence
3184918 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3184918
MKSAGGSGRSLLPSPRVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKA
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| D6RDF8 |
CCND3 |
G1/S-specific cyclin-D3 |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
28 |
| VSL2b |
1 |
27 |
| PrDOS |
1 |
23 |
| PV2 |
1 |
28 |
| IUPred-S |
1 |
9 |
| Espritz-N |
1 |
17 |
| Espritz-X |
1 |
15 |
| Espritz-D |
1 |
47 |
| IUPred-L |
2 |
6 |
| PV2 |
30 |
32 |
| PrDOS |
40 |
47 |
| VLXT |
43 |
43 |
| Espritz-N |
43 |
47 |
| VSL2b |
44 |
47 |
| PV2 |
44 |
47 |
| Espritz-X |
44 |
47 |
| VLXT |
45 |
47 |
| IUPred-S |
45 |
47 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| Cyclin-like |
47954 |
0.00000284 |
|
|
|
16-45 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
CL0065 |
PF00134.18 |
Cyclin_N |
Cyclin, N-terminal domain |
0.000015 |
24.5 |
15 |
47 |
Post Translational Modification Sites
No weak SCOP hits found.