Results for 3182868
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3182868
MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVA
UniProt Gene descriptions
UniProt | Gene Name | Gene Description |
---|---|---|
C9JLS9 | PSMC2 | 26S protease regulatory subunit 7 |
Disordered Regions
75% of predictor's agree:
Start | End |
---|---|
1 | 22 |
By predictor:
Predictor | Start | End |
---|---|---|
VLXT | 1 | 27 |
VSL2b | 1 | 48 |
PrDOS | 1 | 26 |
PV2 | 1 | 35 |
IUPred-S | 1 | 23 |
IUPred-L | 1 | 22 |
Espritz-N | 1 | 18 |
Espritz-X | 1 | 21 |
Espritz-D | 1 | 110 |
IUPred-L | 24 | 24 |
PV2 | 37 | 38 |
VSL2b | 62 | 70 |
PrDOS | 63 | 72 |
Espritz-N | 67 | 71 |
PV2 | 68 | 70 |
PrDOS | 78 | 88 |
IUPred-L | 81 | 81 |
IUPred-S | 83 | 83 |
IUPred-L | 83 | 83 |
VSL2b | 85 | 91 |
PV2 | 86 | 91 |
PV2 | 94 | 94 |
IUPred-L | 98 | 99 |
PrDOS | 125 | 130 |
VSL2b | 126 | 130 |
PV2 | 126 | 130 |
Espritz-N | 127 | 130 |
Espritz-X | 127 | 130 |
VLXT | 128 | 129 |
IUPred-S | 129 | 130 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.