Results for 3182868

PNG SVG

Sequence

3182868 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>3182868
MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVA

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
C9JLS9 PSMC2 26S protease regulatory subunit 7

Disordered Regions

75% of predictor's agree:

Start End
1 22

By predictor:

Predictor Start End
VLXT 1 27
VSL2b 1 48
PrDOS 1 26
PV2 1 35
IUPred-S 1 23
IUPred-L 1 22
Espritz-N 1 18
Espritz-X 1 21
Espritz-D 1 110
IUPred-L 24 24
PV2 37 38
VSL2b 62 70
PrDOS 63 72
Espritz-N 67 71
PV2 68 70
PrDOS 78 88
IUPred-L 81 81
IUPred-S 83 83
IUPred-L 83 83
VSL2b 85 91
PV2 86 91
PV2 94 94
IUPred-L 98 99
PrDOS 125 130
VSL2b 126 130
PV2 126 130
Espritz-N 127 130
Espritz-X 127 130
VLXT 128 129
IUPred-S 129 130

SCOP Domain Regions

Hits with strong support:

No strong SCOP hits found.

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

No Pfam hits found.

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 3182868


comments powered by Disqus