Sequence
3159836 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3159836
MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEAGPESEGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVR
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| C9JZG1 |
EIF3B |
Eukaryotic translation initiation factor 3 subunit B |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
153 |
| VSL2b |
1 |
144 |
| PrDOS |
1 |
134 |
| PV2 |
1 |
143 |
| IUPred-S |
1 |
137 |
| IUPred-L |
1 |
137 |
| Espritz-N |
1 |
143 |
| Espritz-X |
1 |
147 |
| Espritz-D |
1 |
107 |
| IUPred-L |
141 |
141 |
| IUPred-L |
143 |
152 |
| PV2 |
145 |
145 |
| VLXT |
156 |
156 |
| Espritz-N |
182 |
190 |
| VSL2b |
184 |
187 |
| PV2 |
203 |
203 |
| VSL2b |
212 |
212 |
| PrDOS |
237 |
244 |
| PV2 |
244 |
245 |
| PV2 |
248 |
248 |
| PV2 |
256 |
258 |
| PV2 |
266 |
266 |
| Espritz-N |
273 |
276 |
| PV2 |
282 |
282 |
| VLXT |
290 |
296 |
| PV2 |
291 |
302 |
| PrDOS |
294 |
297 |
| VSL2b |
297 |
302 |
| PrDOS |
298 |
302 |
| Espritz-X |
298 |
302 |
| IUPred-S |
299 |
302 |
| Espritz-N |
299 |
302 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| RNA-binding domain, RBD |
54928 |
0.0000000000529 |
|
|
|
161-230 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Pfam-B |
No Clan |
PB006034 |
|
|
1.7e-34 |
120.7 |
16 |
187 |
| Pfam-B |
No Clan |
PB001110 |
|
|
4.899999999999999e-24 |
85.1 |
71 |
302 |
| Domain |
CL0221 |
PF00076.17 |
RRM_1 |
RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) |
0.00000011 |
31.4 |
164 |
221 |
| Pfam-B |
No Clan |
PB006034 |
|
|
0.00000002 |
34.8 |
184 |
299 |
Post Translational Modification Sites
No weak SCOP hits found.