Sequence
3158941 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3158941
MTLIWRHLLRPLCLVTSAPRILEMHPFLSLGTSRTSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQKPLLLHQGHMEWLFDAEGSRYLDFFSGIVTVSVGHCHPKVNAVAQKQLGRLWHTSTVFFHPPMHEYAEKLAALLPEPLKVIFLVNSGSEANELAMLMARAHSNNIDIISFRGAYHGCSPYTLGLTNVGTYKMELPGGTGCQPTMCPDVFRGPWGGSHCRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPKGFLKEAFELVRARGGVCIADEVIKEENLQENSQEVGTYMLLKFAKLRDEFEIVGDVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| E9PDL7 |
AGXT2 |
Alanine--glyoxylate aminotransferase 2, mitochondrial |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| PrDOS |
1 |
66 |
| PV2 |
1 |
21 |
| IUPred-S |
1 |
1 |
| Espritz-X |
2 |
2 |
| PV2 |
23 |
55 |
| VSL2b |
30 |
51 |
| VLXT |
38 |
42 |
| IUPred-S |
41 |
43 |
| IUPred-L |
41 |
41 |
| PV2 |
61 |
61 |
| PV2 |
162 |
162 |
| VSL2b |
173 |
175 |
| PV2 |
173 |
175 |
| VLXT |
175 |
181 |
| PrDOS |
212 |
224 |
| PV2 |
215 |
247 |
| VSL2b |
234 |
253 |
| Espritz-N |
236 |
237 |
| PV2 |
249 |
249 |
| VLXT |
314 |
329 |
| VSL2b |
325 |
333 |
| PV2 |
327 |
327 |
| PV2 |
330 |
331 |
| Espritz-N |
331 |
332 |
| VLXT |
353 |
362 |
| VLXT |
369 |
389 |
| PV2 |
374 |
374 |
| PV2 |
376 |
377 |
| VSL2b |
382 |
382 |
| PV2 |
429 |
439 |
| Espritz-X |
432 |
439 |
| VSL2b |
433 |
439 |
| PrDOS |
433 |
439 |
| IUPred-S |
434 |
439 |
| Espritz-N |
434 |
439 |
| VLXT |
435 |
435 |
| VLXT |
437 |
439 |
| IUPred-L |
437 |
438 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| PLP-dependent transferases |
53383 |
1.66e-76 |
GABA-aminotransferase-like |
53417 |
0.000073 |
72-432 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
CL0061 |
PF00202.16 |
Aminotran_3 |
Aminotransferase class-III |
8.300000000000001e-44 |
149.8 |
87 |
324 |
Post Translational Modification Sites
No weak SCOP hits found.