Results for 3157629

PNG SVG

Sequence

3157629 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>3157629
MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLSALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLRESPLPRDSQESSQSMLKAPGQPCRSPG

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
A6NP52 PRAF2 PRA1 family protein 2

Disordered Regions

75% of predictor's agree:

Start End
137 160

By predictor:

Predictor Start End
VLXT 1 9
VSL2b 1 8
PrDOS 1 9
PV2 1 8
IUPred-S 1 6
Espritz-N 1 5
Espritz-X 1 7
PV2 23 25
PV2 27 27
PV2 53 78
PV2 81 125
VLXT 87 95
Espritz-X 128 160
Espritz-N 129 160
PV2 131 160
VLXT 134 160
VSL2b 134 160
PrDOS 136 160
IUPred-S 137 160
Espritz-D 137 160
IUPred-L 143 146
IUPred-L 148 153
IUPred-L 160 160

SCOP Domain Regions

Hits with strong support:

No strong SCOP hits found.

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Family No Clan PF03208.14 3.3e-28 97.9 1 133

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 3157629


comments powered by Disqus