Results for 3157629
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3157629
MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLSALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLRESPLPRDSQESSQSMLKAPGQPCRSPG
UniProt Gene descriptions
UniProt | Gene Name | Gene Description |
---|---|---|
A6NP52 | PRAF2 | PRA1 family protein 2 |
Disordered Regions
75% of predictor's agree:
Start | End |
---|---|
137 | 160 |
By predictor:
Predictor | Start | End |
---|---|---|
VLXT | 1 | 9 |
VSL2b | 1 | 8 |
PrDOS | 1 | 9 |
PV2 | 1 | 8 |
IUPred-S | 1 | 6 |
Espritz-N | 1 | 5 |
Espritz-X | 1 | 7 |
PV2 | 23 | 25 |
PV2 | 27 | 27 |
PV2 | 53 | 78 |
PV2 | 81 | 125 |
VLXT | 87 | 95 |
Espritz-X | 128 | 160 |
Espritz-N | 129 | 160 |
PV2 | 131 | 160 |
VLXT | 134 | 160 |
VSL2b | 134 | 160 |
PrDOS | 136 | 160 |
IUPred-S | 137 | 160 |
Espritz-D | 137 | 160 |
IUPred-L | 143 | 146 |
IUPred-L | 148 | 153 |
IUPred-L | 160 | 160 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
Type | Clan | Family | Name | Description | E-value | Bitscore | Start | End |
---|---|---|---|---|---|---|---|---|
Family | No Clan | PF03208.14 | 3.3e-28 | 97.9 | 1 | 133 |