Results for 3148668
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3148668
MFEPNSPRRGGARYQWPEGAQVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
UniProt Gene descriptions
| UniProt | Gene Name | Gene Description |
|---|---|---|
| A6NEL0 | HMGN1 | Non-histone chromosomal protein HMG-14 |
Disordered Regions
75% of predictor's agree:
| Start | End |
|---|---|
| 1 | 116 |
By predictor:
| Predictor | Start | End |
|---|---|---|
| VLXT | 1 | 116 |
| VSL2b | 1 | 116 |
| PrDOS | 1 | 116 |
| PV2 | 1 | 116 |
| IUPred-S | 1 | 116 |
| IUPred-L | 1 | 116 |
| Espritz-N | 1 | 116 |
| Espritz-X | 1 | 116 |
| Espritz-D | 1 | 116 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type | Clan | Family | Name | Description | E-value | Bitscore | Start | End |
|---|---|---|---|---|---|---|---|---|
| Family | No Clan | PF01101.13 | 1.0000000000000001e-23 | 83.8 | 7 | 112 |