Results for 26709734
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>26709734
MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKIIGDLKRLLQRLSCGM
UniProt Gene descriptions
| UniProt | Gene Name | Gene Description |
|---|---|---|
| F5H120 | FKBP4 | Peptidyl-prolyl cis-trans isomerase FKBP4, N-terminally processed |
Disordered Regions
75% of predictor's agree:
| Start | End |
|---|---|
| 1 | 26 |
By predictor:
| Predictor | Start | End |
|---|---|---|
| VLXT | 1 | 41 |
| VSL2b | 1 | 35 |
| PrDOS | 1 | 26 |
| PV2 | 1 | 35 |
| IUPred-S | 1 | 25 |
| IUPred-L | 1 | 25 |
| Espritz-N | 1 | 32 |
| Espritz-X | 1 | 17 |
| Espritz-D | 1 | 51 |
| PrDOS | 43 | 51 |
| VSL2b | 47 | 51 |
| PV2 | 47 | 51 |
| IUPred-S | 48 | 51 |
| Espritz-N | 49 | 51 |
| Espritz-X | 49 | 51 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.