Results for 26706123

PNG SVG

Sequence

26706123 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>26706123
MRSLLLLSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQTTDGKLPEVT

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
E9PQ34 SERPINH1 Serpin H1

Disordered Regions

75% of predictor's agree:

Start End
31 40
47 48
134 142

By predictor:

Predictor Start End
VLXT 1 1
VSL2b 1 5
PrDOS 1 11
PV2 1 64
IUPred-S 1 1
Espritz-N 1 3
Espritz-X 1 35
VLXT 3 4
VSL2b 9 74
Espritz-N 22 56
IUPred-L 28 40
VLXT 31 41
PrDOS 31 35
Espritz-D 32 140
IUPred-S 38 40
Espritz-X 40 46
VLXT 45 68
IUPred-L 47 48
Espritz-N 58 64
PV2 70 72
Espritz-N 71 75
VLXT 79 83
PV2 89 89
PV2 91 93
PV2 95 101
VSL2b 97 99
VSL2b 103 110
PV2 103 105
Espritz-N 105 105
PV2 107 110
IUPred-L 111 111
PrDOS 113 115
PV2 115 120
VSL2b 116 118
PV2 123 126
IUPred-L 127 129
Espritz-X 129 142
PrDOS 130 142
VLXT 133 142
IUPred-S 134 142
IUPred-L 134 142
Espritz-N 134 142
PV2 135 142
VSL2b 136 142

SCOP Domain Regions

Hits with strong support:

Superfamily Name SFam ID SFam E-value Family Name Fam ID Fam E-value Region
Serpins 56574 7.33e-20 38-141

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Domain No Clan PF00079.15 Serpin Serpin (serine protease inhibitor) 3e-18 66.1 34 142

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 26706123


comments powered by Disqus