Results for 26702232
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>26702232
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHT
UniProt Gene descriptions
| UniProt | Gene Name | Gene Description |
|---|---|---|
| E5RJ16 | AZIN1 | Antizyme inhibitor 1 |
Disordered Regions
75% of predictor's agree:
| Start | End |
|---|---|
| 1 | 3 |
By predictor:
| Predictor | Start | End |
|---|---|---|
| VLXT | 1 | 3 |
| VSL2b | 1 | 6 |
| PrDOS | 1 | 11 |
| PV2 | 1 | 3 |
| IUPred-S | 1 | 4 |
| Espritz-N | 1 | 6 |
| Espritz-X | 1 | 6 |
| Espritz-D | 1 | 33 |
| PrDOS | 27 | 33 |
| VSL2b | 29 | 33 |
| IUPred-S | 30 | 33 |
| PV2 | 31 | 33 |
| Espritz-X | 31 | 33 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.