Sequence
10726464 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>10726464
MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSGK
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| F1LSG0 |
Wasl |
Neural Wiskott-Aldrich syndrome protein |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
19 |
| VSL2b |
1 |
17 |
| PrDOS |
1 |
17 |
| PV2 |
1 |
24 |
| IUPred-S |
1 |
17 |
| IUPred-L |
1 |
6 |
| Espritz-N |
1 |
15 |
| Espritz-X |
1 |
14 |
| IUPred-L |
13 |
15 |
| VSL2b |
20 |
25 |
| VSL2b |
121 |
129 |
| PV2 |
121 |
129 |
| VLXT |
126 |
144 |
| PV2 |
131 |
144 |
| PrDOS |
132 |
144 |
| VSL2b |
134 |
144 |
| Espritz-X |
134 |
144 |
| IUPred-S |
137 |
144 |
| Espritz-N |
137 |
144 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| PH domain-like |
50729 |
4.14e-41 |
Enabled/VASP homology 1 domain (EVH1 domain) |
50767 |
0.000000735 |
27-138 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
CL0266 |
PF00568.18 |
WH1 |
WH1 domain |
5.3e-42 |
142 |
28 |
135 |
Post Translational Modification Sites
No weak SCOP hits found.