Results for 3243227

PNG SVG

Sequence

3243227 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>3243227
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEATICEKSSAVDILLSRDKLLSETCLS

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
A2AAB6 Klf7 Kruppel-like factor 7 (Ubiquitous)

Disordered Regions

75% of predictor's agree:

No agreed upon disordered regions found.

By predictor:

Predictor Start End
VLXT 1 1
VSL2b 1 4
PrDOS 1 10
PV2 1 4
IUPred-S 1 3
Espritz-N 1 3
Espritz-X 1 3
VLXT 34 49
PV2 39 40
VSL2b 44 60
PV2 44 68
PrDOS 45 75
VSL2b 63 79
PV2 70 74
VLXT 76 85
PV2 76 78
VSL2b 81 81
PV2 81 81
VSL2b 86 111
PV2 86 89
VLXT 89 91
PrDOS 90 111
VLXT 94 97
PV2 95 111
Espritz-X 106 111
IUPred-S 109 111

SCOP Domain Regions

Hits with strong support:

No strong SCOP hits found.

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Pfam-B No Clan PB011950 7e-36 122.4 1 89
Pfam-B No Clan PB004839 6.6e-20 72.4 1 56
Pfam-B No Clan PB016238 0.0000021 28.3 91 111

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 3243227


comments powered by Disqus