Results for 3243227
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3243227
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEATICEKSSAVDILLSRDKLLSETCLS
UniProt Gene descriptions
UniProt | Gene Name | Gene Description |
---|---|---|
A2AAB6 | Klf7 | Kruppel-like factor 7 (Ubiquitous) |
Disordered Regions
75% of predictor's agree:
No agreed upon disordered regions found.
By predictor:
Predictor | Start | End |
---|---|---|
VLXT | 1 | 1 |
VSL2b | 1 | 4 |
PrDOS | 1 | 10 |
PV2 | 1 | 4 |
IUPred-S | 1 | 3 |
Espritz-N | 1 | 3 |
Espritz-X | 1 | 3 |
VLXT | 34 | 49 |
PV2 | 39 | 40 |
VSL2b | 44 | 60 |
PV2 | 44 | 68 |
PrDOS | 45 | 75 |
VSL2b | 63 | 79 |
PV2 | 70 | 74 |
VLXT | 76 | 85 |
PV2 | 76 | 78 |
VSL2b | 81 | 81 |
PV2 | 81 | 81 |
VSL2b | 86 | 111 |
PV2 | 86 | 89 |
VLXT | 89 | 91 |
PrDOS | 90 | 111 |
VLXT | 94 | 97 |
PV2 | 95 | 111 |
Espritz-X | 106 | 111 |
IUPred-S | 109 | 111 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.