Sequence
26704937 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>26704937
MPSATSHSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLL
View in source genome browser
UniProt Gene descriptions
UniProt |
Gene Name |
Gene Description |
E9PLA9 |
CAPRIN1 |
Caprin-1 |
Disordered Regions
75% of predictor's agree:
Start |
End |
1 |
53 |
71 |
73 |
81 |
95 |
By predictor:
Predictor |
Start |
End |
VLXT |
1 |
50 |
VSL2b |
1 |
168 |
PrDOS |
1 |
51 |
PV2 |
1 |
98 |
IUPred-S |
1 |
50 |
IUPred-L |
1 |
53 |
Espritz-N |
1 |
53 |
Espritz-X |
1 |
60 |
Espritz-D |
1 |
57 |
VLXT |
61 |
95 |
Espritz-X |
65 |
73 |
IUPred-L |
69 |
96 |
PrDOS |
71 |
96 |
IUPred-S |
76 |
83 |
Espritz-N |
81 |
85 |
Espritz-D |
82 |
101 |
IUPred-S |
86 |
86 |
IUPred-S |
89 |
89 |
IUPred-L |
99 |
100 |
PV2 |
120 |
120 |
VLXT |
123 |
147 |
PrDOS |
124 |
140 |
PV2 |
125 |
149 |
IUPred-L |
129 |
138 |
IUPred-L |
140 |
140 |
PV2 |
154 |
154 |
PV2 |
164 |
164 |
VLXT |
167 |
185 |
IUPred-L |
171 |
171 |
Espritz-N |
173 |
173 |
PV2 |
176 |
177 |
PrDOS |
178 |
182 |
VSL2b |
179 |
186 |
PV2 |
179 |
186 |
Espritz-X |
179 |
186 |
Espritz-N |
182 |
186 |
PrDOS |
183 |
186 |
IUPred-S |
183 |
186 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
G protein-binding domain |
103652 |
0.00518 |
|
|
|
98-142 |
Pfam Domain Regions
Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
Pfam-B |
No Clan |
PB003428 |
|
|
6.2e-19 |
69.1 |
34 |
118 |
Pfam-B |
No Clan |
PB003428 |
|
|
1.9e-16 |
60.9 |
113 |
186 |
Post Translational Modification Sites
No weak SCOP hits found.