Results for 26704937

PNG SVG

Sequence

26704937 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>26704937
MPSATSHSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLL

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
E9PLA9 CAPRIN1 Caprin-1

Disordered Regions

75% of predictor's agree:

Start End
1 53
71 73
81 95

By predictor:

Predictor Start End
VLXT 1 50
VSL2b 1 168
PrDOS 1 51
PV2 1 98
IUPred-S 1 50
IUPred-L 1 53
Espritz-N 1 53
Espritz-X 1 60
Espritz-D 1 57
VLXT 61 95
Espritz-X 65 73
IUPred-L 69 96
PrDOS 71 96
IUPred-S 76 83
Espritz-N 81 85
Espritz-D 82 101
IUPred-S 86 86
IUPred-S 89 89
IUPred-L 99 100
PV2 120 120
VLXT 123 147
PrDOS 124 140
PV2 125 149
IUPred-L 129 138
IUPred-L 140 140
PV2 154 154
PV2 164 164
VLXT 167 185
IUPred-L 171 171
Espritz-N 173 173
PV2 176 177
PrDOS 178 182
VSL2b 179 186
PV2 179 186
Espritz-X 179 186
Espritz-N 182 186
PrDOS 183 186
IUPred-S 183 186

SCOP Domain Regions

Hits with strong support:

No strong SCOP hits found.

Hits with weaker support:

Superfamily Name SFam ID SFam E-value Family Name Fam ID Fam E-value Region
G protein-binding domain 103652 0.00518 98-142

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Pfam-B No Clan PB003428 6.2e-19 69.1 34 118
Pfam-B No Clan PB003428 1.9e-16 60.9 113 186

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 26704937


comments powered by Disqus