Results for 9702611
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>9702611
MSIMSYNGGAVMAMRGKECVAIASDRRFGIQAQLVTTDFQKIFPMGERLYIGLAGLATDVQTVSQRLKFRLNLYELKEGRQIKPRTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPFICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPDMKPEDLFETISQAMLNAVDRDAVSGMGVVVHVIEKDKITTRTLKARMD
UniProt Gene descriptions
| UniProt | Gene Name | Gene Description |
|---|---|---|
| Q7ZUJ8 | psmb3 | Proteasome subunit beta type |
Disordered Regions
75% of predictor's agree:
No agreed upon disordered regions found.
By predictor:
| Predictor | Start | End |
|---|---|---|
| VLXT | 1 | 1 |
| VSL2b | 1 | 7 |
| PrDOS | 1 | 4 |
| PV2 | 1 | 7 |
| IUPred-S | 1 | 4 |
| Espritz-N | 1 | 16 |
| Espritz-X | 1 | 5 |
| PrDOS | 5 | 6 |
| VLXT | 71 | 81 |
| VSL2b | 157 | 157 |
| PV2 | 157 | 157 |
| VLXT | 160 | 171 |
| VSL2b | 160 | 160 |
| PV2 | 160 | 160 |
| VSL2b | 199 | 205 |
| PV2 | 199 | 205 |
| Espritz-N | 199 | 205 |
| IUPred-S | 200 | 205 |
| PrDOS | 202 | 205 |
| VLXT | 203 | 203 |
| Espritz-X | 203 | 205 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name | SFam ID | SFam E-value | Family Name | Fam ID | Fam E-value | Region |
|---|---|---|---|---|---|---|
| N-terminal nucleophile aminohydrolases (Ntn hydrolases) | 56235 | 1.65e-57 | Proteasome subunits | 56251 | 0.00000000751 | 3-205 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type | Clan | Family | Name | Description | E-value | Bitscore | Start | End |
|---|---|---|---|---|---|---|---|---|
| Domain | CL0052 | PF00227.21 | Proteasome | Proteasome subunit | 1.4e-42 | 145.1 | 5 | 190 |