Sequence
4415093 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>4415093
MSRKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRV
View in source genome browser
UniProt Gene descriptions
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
7 |
| VSL2b |
1 |
7 |
| PrDOS |
1 |
12 |
| PV2 |
1 |
7 |
| IUPred-S |
1 |
7 |
| Espritz-N |
1 |
3 |
| Espritz-X |
1 |
6 |
| Espritz-D |
1 |
23 |
| Espritz-D |
46 |
52 |
| Espritz-D |
54 |
61 |
| Espritz-D |
63 |
79 |
| PV2 |
72 |
73 |
| PrDOS |
74 |
79 |
| VSL2b |
75 |
79 |
| PV2 |
75 |
79 |
| IUPred-S |
75 |
79 |
| Espritz-X |
76 |
79 |
| VLXT |
77 |
79 |
| Espritz-N |
77 |
79 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| Sm-like ribonucleoproteins |
50182 |
8.39e-20 |
|
|
|
8-74 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
CL0527 |
PF01423.17 |
LSM |
LSM domain |
9.2e-17 |
60.3 |
9 |
74 |
Post Translational Modification Sites
No weak SCOP hits found.