Results for 3364747

PNG SVG

Sequence

3364747 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>3364747
MVVKKPRPKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKARELAQKQG

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
B4R5M2 GD16190 GD16190
P46223 RpL7A 60S ribosomal protein L7a
Q6XIQ0 RpL7A Similar to Drosophila melanogaster RpL7A

Disordered Regions

75% of predictor's agree:

Start End
1 18
128 128
269 270

By predictor:

Predictor Start End
VLXT 1 30
VSL2b 1 56
PrDOS 1 36
PV2 1 29
IUPred-S 1 18
IUPred-L 1 20
Espritz-N 1 13
Espritz-X 1 15
Espritz-D 1 32
PV2 34 36
PrDOS 39 52
PV2 41 41
Espritz-N 42 57
PV2 43 60
IUPred-L 43 44
IUPred-L 47 50
IUPred-S 48 49
VLXT 54 79
PV2 65 65
PV2 67 67
PrDOS 69 83
PV2 69 71
PV2 73 92
VSL2b 76 144
IUPred-L 86 86
PrDOS 92 141
PV2 97 98
PV2 100 100
PV2 102 102
PV2 108 145
VLXT 109 132
Espritz-N 124 146
IUPred-L 128 128
IUPred-S 129 130
IUPred-S 133 133
IUPred-L 133 140
IUPred-S 135 138
PV2 170 171
PV2 179 179
VLXT 186 204
PrDOS 207 219
VSL2b 216 216
VLXT 228 234
PV2 230 235
VSL2b 233 238
PV2 237 242
VLXT 245 269
PV2 245 245
VSL2b 247 271
PrDOS 247 254
PV2 247 271
Espritz-X 256 271
PrDOS 257 271
IUPred-S 264 271
Espritz-N 267 271
IUPred-L 269 271

SCOP Domain Regions

Hits with strong support:

Superfamily Name SFam ID SFam E-value Family Name Fam ID Fam E-value Region
CATH -7 3.04e-55 CATH -10 0.00000149 62-237
L30e-like 55315 3.54e-34 98-232

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Domain CL0101 PF01248.21 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family 9.3e-25 85.9 125 221

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 3364747


comments powered by Disqus