Sequence
3250806 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3250806
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSRVTGAVRLAKPGRLQRQR
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| E0CYL6 |
Psma3 |
Proteasome subunit alpha type-3 |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
2 |
| VSL2b |
1 |
8 |
| PrDOS |
1 |
14 |
| PV2 |
1 |
8 |
| IUPred-S |
1 |
6 |
| Espritz-N |
1 |
18 |
| Espritz-X |
1 |
20 |
| Espritz-D |
1 |
52 |
| VLXT |
29 |
52 |
| IUPred-L |
39 |
52 |
| VSL2b |
41 |
52 |
| PrDOS |
42 |
52 |
| PV2 |
42 |
52 |
| IUPred-S |
42 |
52 |
| Espritz-N |
43 |
52 |
| Espritz-X |
43 |
52 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| N-terminal nucleophile aminohydrolases (Ntn hydrolases) |
56235 |
0.00000000000772 |
|
|
|
3-41 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
No Clan |
PF10584.4 |
Proteasome_A_N |
Proteasome subunit A N-terminal signature |
0.0000000000000012 |
56.4 |
8 |
30 |
Post Translational Modification Sites
No weak SCOP hits found.