Sequence
3238510 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3238510
MMAGAEAPQPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLIQNKSHDDPKDEKEKHSGAQVEFADIGCGYGGLLVALSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPGGGFQNIACLRSNAMKHLPNFFRKGQLAKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGPCLQHCRSSRAWCTPSPTCRSCMSGCAPTLKNTHCLSVCLLKS
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| D3Z7D2 |
Mettl1 |
tRNA (guanine-N(7)-)-methyltransferase |
Disordered Regions
75% of predictor's agree:
| Start |
End |
| 1 |
20 |
| 25 |
29 |
| 31 |
31 |
| 55 |
69 |
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
31 |
| VSL2b |
1 |
43 |
| PrDOS |
1 |
14 |
| PV2 |
1 |
32 |
| IUPred-S |
1 |
21 |
| IUPred-L |
1 |
3 |
| Espritz-N |
1 |
83 |
| Espritz-X |
1 |
22 |
| Espritz-D |
2 |
29 |
| IUPred-L |
6 |
19 |
| IUPred-L |
25 |
31 |
| IUPred-S |
26 |
30 |
| Espritz-D |
31 |
31 |
| PV2 |
36 |
36 |
| PV2 |
38 |
71 |
| Espritz-X |
48 |
69 |
| IUPred-S |
51 |
51 |
| PrDOS |
52 |
72 |
| VSL2b |
53 |
70 |
| IUPred-S |
53 |
69 |
| IUPred-L |
54 |
69 |
| VLXT |
109 |
113 |
| VSL2b |
198 |
228 |
| PV2 |
198 |
228 |
| PrDOS |
213 |
228 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| S-adenosyl-L-methionine-dependent methyltransferases |
53335 |
0.0000000000000209 |
|
|
|
61-185 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Family |
CL0063 |
PF02390.12 |
Methyltransf_4 |
Putative methyltransferase |
1.1999999999999999e-41 |
141.8 |
29 |
191 |
Post Translational Modification Sites
No weak SCOP hits found.