Results for 3225026
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3225026
MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPGGSVWGVAYKLPVGKEEEVKTYLDFREKGGYRTTTVIFYPKDSTTKPFSVLLYIGTCDNPNYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELADSVRKLVPEDADEHLFSLEKLVKERLEGK
UniProt Gene descriptions
| UniProt | Gene Name | Gene Description |
|---|---|---|
| Q9CQG1 | Chac2 | Cation transport regulator-like protein 2 |
Disordered Regions
75% of predictor's agree:
No agreed upon disordered regions found.
By predictor:
| Predictor | Start | End |
|---|---|---|
| PrDOS | 1 | 3 |
| PV2 | 25 | 25 |
| VSL2b | 36 | 46 |
| PV2 | 36 | 46 |
| Espritz-N | 36 | 44 |
| IUPred-S | 39 | 39 |
| VLXT | 40 | 50 |
| IUPred-S | 44 | 44 |
| IUPred-L | 44 | 48 |
| IUPred-S | 47 | 50 |
| PV2 | 53 | 57 |
| PV2 | 70 | 72 |
| PV2 | 103 | 103 |
| VLXT | 122 | 138 |
| IUPred-L | 130 | 131 |
| Espritz-N | 135 | 140 |
| PV2 | 140 | 141 |
| VLXT | 141 | 141 |
| VLXT | 145 | 178 |
| VSL2b | 156 | 178 |
| PV2 | 156 | 156 |
| PV2 | 160 | 160 |
| Espritz-X | 163 | 164 |
| PV2 | 165 | 178 |
| Espritz-X | 171 | 178 |
| PrDOS | 175 | 178 |
| IUPred-S | 175 | 178 |
| Espritz-N | 176 | 178 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name | SFam ID | SFam E-value | Family Name | Fam ID | Fam E-value | Region |
|---|---|---|---|---|---|---|
| Gamma-glutamyl cyclotransferase-like | 110857 | 0.00000000131 | 1-121 |
Hits with weaker support:
No weak SCOP hits found.