Sequence
3215022 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3215022
MKLFQRSTPAITLENPDIKYPLRLIDKEVISPDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMKIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNP
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| F2Z3V0 |
Cyb5r3 |
NADH-cytochrome b5 reductase 3 |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
8 |
| VSL2b |
1 |
5 |
| PrDOS |
1 |
14 |
| PV2 |
1 |
5 |
| IUPred-S |
1 |
8 |
| Espritz-N |
1 |
9 |
| Espritz-X |
1 |
9 |
| VLXT |
14 |
14 |
| PV2 |
14 |
14 |
| VLXT |
18 |
31 |
| Espritz-N |
73 |
80 |
| VSL2b |
75 |
80 |
| PV2 |
77 |
77 |
| PV2 |
79 |
84 |
| PrDOS |
94 |
105 |
| PV2 |
95 |
96 |
| VSL2b |
97 |
101 |
| PV2 |
98 |
99 |
| PV2 |
103 |
104 |
| PV2 |
111 |
111 |
| PV2 |
134 |
144 |
| VLXT |
135 |
144 |
| PrDOS |
136 |
144 |
| VSL2b |
137 |
144 |
| IUPred-S |
137 |
144 |
| Espritz-X |
137 |
144 |
| IUPred-L |
139 |
140 |
| Espritz-N |
139 |
144 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| Riboflavin synthase domain-like |
63380 |
9.7e-42 |
Ferredoxin reductase FAD-binding domain-like |
63381 |
0.000000604 |
12-130 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
CL0076 |
PF00970.19 |
FAD_binding_6 |
Oxidoreductase FAD-binding domain |
6.3e-34 |
116 |
21 |
128 |
Post Translational Modification Sites
No weak SCOP hits found.