Results for 3209919

PNG SVG

Sequence

3209919 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>3209919
MRFLMSGWLSTYTWRCDPIDFSNSPEALRMVRVAWLFMLSKVIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTIFFILFSNFWYHSYTKGKRLPRAVQQNGAPATTKVKAN

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
Q4V9V3 Elovl1 Elongation of very long chain fatty acids protein 1

Disordered Regions

75% of predictor's agree:

No agreed upon disordered regions found.

By predictor:

Predictor Start End
VLXT 1 2
VSL2b 1 3
PrDOS 1 4
PV2 1 3
IUPred-S 1 2
Espritz-N 1 6
Espritz-X 1 4
PV2 33 33
PV2 46 48
PV2 50 51
PV2 80 83
PV2 90 90
PV2 113 113
PV2 115 115
PV2 117 120
PV2 127 127
PV2 139 140
PV2 143 155
VSL2b 181 202
PrDOS 181 202
PV2 181 202
Espritz-X 181 202
VLXT 184 195
IUPred-S 189 189
IUPred-S 191 191
Espritz-N 191 202
IUPred-S 193 202
IUPred-L 199 199

SCOP Domain Regions

Hits with strong support:

No strong SCOP hits found.

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Family No Clan PF01151.13 3.1999999999999996e-49 167.5 2 186

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 3209919


comments powered by Disqus