Results for 3209919
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3209919
MRFLMSGWLSTYTWRCDPIDFSNSPEALRMVRVAWLFMLSKVIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTIFFILFSNFWYHSYTKGKRLPRAVQQNGAPATTKVKAN
UniProt Gene descriptions
UniProt | Gene Name | Gene Description |
---|---|---|
Q4V9V3 | Elovl1 | Elongation of very long chain fatty acids protein 1 |
Disordered Regions
75% of predictor's agree:
No agreed upon disordered regions found.
By predictor:
Predictor | Start | End |
---|---|---|
VLXT | 1 | 2 |
VSL2b | 1 | 3 |
PrDOS | 1 | 4 |
PV2 | 1 | 3 |
IUPred-S | 1 | 2 |
Espritz-N | 1 | 6 |
Espritz-X | 1 | 4 |
PV2 | 33 | 33 |
PV2 | 46 | 48 |
PV2 | 50 | 51 |
PV2 | 80 | 83 |
PV2 | 90 | 90 |
PV2 | 113 | 113 |
PV2 | 115 | 115 |
PV2 | 117 | 120 |
PV2 | 127 | 127 |
PV2 | 139 | 140 |
PV2 | 143 | 155 |
VSL2b | 181 | 202 |
PrDOS | 181 | 202 |
PV2 | 181 | 202 |
Espritz-X | 181 | 202 |
VLXT | 184 | 195 |
IUPred-S | 189 | 189 |
IUPred-S | 191 | 191 |
Espritz-N | 191 | 202 |
IUPred-S | 193 | 202 |
IUPred-L | 199 | 199 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
Type | Clan | Family | Name | Description | E-value | Bitscore | Start | End |
---|---|---|---|---|---|---|---|---|
Family | No Clan | PF01151.13 | 3.1999999999999996e-49 | 167.5 | 2 | 186 |