Sequence
3202479 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3202479
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSRKNEESQEVC
View in source genome browser
UniProt Gene descriptions
UniProt |
Gene Name |
Gene Description |
D6REE7 |
ROCK2 |
Rho-associated protein kinase 2 |
Disordered Regions
75% of predictor's agree:
Start |
End |
1 |
30 |
390 |
390 |
431 |
446 |
By predictor:
Predictor |
Start |
End |
VLXT |
1 |
41 |
VSL2b |
1 |
44 |
PrDOS |
1 |
39 |
PV2 |
1 |
44 |
IUPred-S |
1 |
33 |
IUPred-L |
1 |
31 |
Espritz-N |
1 |
29 |
Espritz-X |
1 |
36 |
Espritz-D |
1 |
27 |
IUPred-L |
34 |
34 |
VLXT |
80 |
88 |
VSL2b |
218 |
221 |
PV2 |
220 |
221 |
Espritz-N |
251 |
255 |
VLXT |
254 |
256 |
PV2 |
258 |
259 |
VSL2b |
263 |
266 |
Espritz-N |
265 |
269 |
PV2 |
340 |
340 |
PV2 |
342 |
342 |
PV2 |
353 |
356 |
PV2 |
363 |
364 |
PV2 |
366 |
398 |
VLXT |
372 |
395 |
IUPred-S |
372 |
374 |
VSL2b |
374 |
393 |
Espritz-N |
374 |
393 |
IUPred-S |
376 |
377 |
IUPred-S |
379 |
384 |
IUPred-L |
382 |
384 |
IUPred-S |
386 |
387 |
PrDOS |
387 |
407 |
IUPred-L |
387 |
387 |
IUPred-S |
389 |
389 |
IUPred-L |
390 |
390 |
IUPred-S |
391 |
391 |
PrDOS |
420 |
446 |
Espritz-X |
420 |
446 |
PV2 |
421 |
446 |
VSL2b |
423 |
446 |
VLXT |
427 |
442 |
Espritz-N |
430 |
446 |
IUPred-L |
431 |
446 |
IUPred-S |
432 |
436 |
Espritz-D |
437 |
443 |
IUPred-S |
439 |
446 |
VLXT |
444 |
444 |
SCOP Domain Regions
Hits with strong support:
Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
Protein kinase-like (PK-like) |
56112 |
5.8e-86 |
Protein kinases, catalytic subunit |
88854 |
0.00000252 |
89-413 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
Domain |
CL0016 |
PF00069.20 |
Pkinase |
Protein kinase domain |
1.9e-61 |
207.4 |
92 |
354 |
Post Translational Modification Sites
No weak SCOP hits found.