Results for 3202479

PNG SVG

Sequence

3202479 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>3202479
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSRKNEESQEVC

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
D6REE7 ROCK2 Rho-associated protein kinase 2

Disordered Regions

75% of predictor's agree:

Start End
1 30
390 390
431 446

By predictor:

Predictor Start End
VLXT 1 41
VSL2b 1 44
PrDOS 1 39
PV2 1 44
IUPred-S 1 33
IUPred-L 1 31
Espritz-N 1 29
Espritz-X 1 36
Espritz-D 1 27
IUPred-L 34 34
VLXT 80 88
VSL2b 218 221
PV2 220 221
Espritz-N 251 255
VLXT 254 256
PV2 258 259
VSL2b 263 266
Espritz-N 265 269
PV2 340 340
PV2 342 342
PV2 353 356
PV2 363 364
PV2 366 398
VLXT 372 395
IUPred-S 372 374
VSL2b 374 393
Espritz-N 374 393
IUPred-S 376 377
IUPred-S 379 384
IUPred-L 382 384
IUPred-S 386 387
PrDOS 387 407
IUPred-L 387 387
IUPred-S 389 389
IUPred-L 390 390
IUPred-S 391 391
PrDOS 420 446
Espritz-X 420 446
PV2 421 446
VSL2b 423 446
VLXT 427 442
Espritz-N 430 446
IUPred-L 431 446
IUPred-S 432 436
Espritz-D 437 443
IUPred-S 439 446
VLXT 444 444

SCOP Domain Regions

Hits with strong support:

Superfamily Name SFam ID SFam E-value Family Name Fam ID Fam E-value Region
Protein kinase-like (PK-like) 56112 5.8e-86 Protein kinases, catalytic subunit 88854 0.00000252 89-413

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Domain CL0016 PF00069.20 Pkinase Protein kinase domain 1.9e-61 207.4 92 354

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 3202479


comments powered by Disqus