Results for 3174460
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3174460
MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGASALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMG
UniProt Gene descriptions
UniProt | Gene Name | Gene Description |
---|---|---|
C9JK50 | MAGEA4 | Melanoma-associated antigen 4 |
Disordered Regions
75% of predictor's agree:
Start | End |
---|---|
1 | 76 |
81 | 106 |
By predictor:
Predictor | Start | End |
---|---|---|
VLXT | 1 | 71 |
VSL2b | 1 | 116 |
PrDOS | 1 | 109 |
PV2 | 1 | 116 |
IUPred-S | 1 | 107 |
IUPred-L | 1 | 77 |
Espritz-N | 1 | 115 |
Espritz-X | 1 | 109 |
Espritz-D | 1 | 68 |
IUPred-L | 80 | 106 |
VLXT | 84 | 111 |
VLXT | 127 | 136 |
PrDOS | 187 | 199 |
VLXT | 210 | 225 |
VSL2b | 213 | 230 |
PV2 | 214 | 215 |
PV2 | 218 | 218 |
PV2 | 220 | 230 |
IUPred-S | 222 | 230 |
PrDOS | 228 | 230 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
Type | Clan | Family | Name | Description | E-value | Bitscore | Start | End |
---|---|---|---|---|---|---|---|---|
Family | No Clan | PF12440.3 | 1.1e-32 | 112.2 | 3 | 99 | ||
Family | No Clan | PF01454.14 | MAGE | MAGE family | 2.7e-29 | 101.9 | 117 | 230 |