Results for 3174460

PNG SVG

Sequence

3174460 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>3174460
MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGASALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMG

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
C9JK50 MAGEA4 Melanoma-associated antigen 4

Disordered Regions

75% of predictor's agree:

Start End
1 76
81 106

By predictor:

Predictor Start End
VLXT 1 71
VSL2b 1 116
PrDOS 1 109
PV2 1 116
IUPred-S 1 107
IUPred-L 1 77
Espritz-N 1 115
Espritz-X 1 109
Espritz-D 1 68
IUPred-L 80 106
VLXT 84 111
VLXT 127 136
PrDOS 187 199
VLXT 210 225
VSL2b 213 230
PV2 214 215
PV2 218 218
PV2 220 230
IUPred-S 222 230
PrDOS 228 230

SCOP Domain Regions

Hits with strong support:

No strong SCOP hits found.

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Family No Clan PF12440.3 1.1e-32 112.2 3 99
Family No Clan PF01454.14 MAGE MAGE family 2.7e-29 101.9 117 230

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 3174460


comments powered by Disqus