Results for 3158574
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3158574
MSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATVQSVPKNSDPWAASQQPASSAGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFLAPGAPATSAPVNPFQVNQPQPLTLNQLRGSPVLGTSTSFGPGPGVESMAVASMTSAAPQPALGATGSSLTPLGPAMMNMVGSVGIPPSAAQATGTTNPFLL
UniProt Gene descriptions
UniProt | Gene Name | Gene Description |
---|---|---|
A8MTV8 | EPN2 | Epsin-2 |
Disordered Regions
75% of predictor's agree:
Start | End |
---|---|
1 | 150 |
172 | 229 |
242 | 326 |
328 | 328 |
332 | 333 |
335 | 336 |
338 | 356 |
By predictor:
Predictor | Start | End |
---|---|---|
VLXT | 1 | 39 |
VSL2b | 1 | 356 |
PrDOS | 1 | 231 |
PV2 | 1 | 157 |
IUPred-S | 1 | 10 |
IUPred-L | 1 | 149 |
Espritz-N | 1 | 18 |
Espritz-X | 1 | 231 |
Espritz-D | 1 | 201 |
IUPred-S | 17 | 18 |
IUPred-S | 22 | 24 |
Espritz-N | 25 | 356 |
IUPred-S | 29 | 140 |
VLXT | 48 | 95 |
VLXT | 107 | 148 |
IUPred-L | 161 | 161 |
PV2 | 172 | 356 |
IUPred-L | 172 | 229 |
VLXT | 180 | 220 |
IUPred-S | 187 | 227 |
IUPred-L | 231 | 243 |
VLXT | 237 | 259 |
PrDOS | 242 | 356 |
Espritz-X | 242 | 250 |
IUPred-L | 245 | 326 |
IUPred-S | 251 | 256 |
IUPred-S | 259 | 259 |
Espritz-X | 259 | 264 |
VLXT | 264 | 348 |
IUPred-S | 265 | 278 |
IUPred-S | 280 | 285 |
IUPred-S | 288 | 295 |
IUPred-S | 299 | 301 |
Espritz-X | 304 | 323 |
IUPred-S | 305 | 306 |
IUPred-S | 317 | 317 |
IUPred-S | 320 | 320 |
IUPred-L | 328 | 328 |
IUPred-L | 330 | 333 |
IUPred-L | 335 | 356 |
Espritz-X | 344 | 356 |
IUPred-S | 349 | 356 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
Type | Clan | Family | Name | Description | E-value | Bitscore | Start | End |
---|---|---|---|---|---|---|---|---|
Pfam-B | No Clan | PB015198 | 6.3e-16 | 59.4 | 42 | 307 |