Sequence
3153292 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3153292
MELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| Q5JPU3 |
PDHA1 |
Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial |
Disordered Regions
75% of predictor's agree:
| Start |
End |
| 2 |
2 |
| 5 |
6 |
| 9 |
9 |
| 14 |
15 |
| 17 |
26 |
| 70 |
77 |
By predictor:
| Predictor |
Start |
End |
| VSL2b |
1 |
81 |
| PrDOS |
1 |
6 |
| PV2 |
1 |
51 |
| IUPred-S |
1 |
10 |
| Espritz-N |
1 |
18 |
| Espritz-X |
1 |
5 |
| Espritz-D |
1 |
109 |
| VLXT |
2 |
2 |
| IUPred-L |
5 |
6 |
| IUPred-L |
8 |
8 |
| VLXT |
9 |
81 |
| PrDOS |
9 |
28 |
| IUPred-S |
14 |
26 |
| IUPred-L |
14 |
14 |
| IUPred-L |
17 |
26 |
| IUPred-L |
31 |
31 |
| PV2 |
55 |
83 |
| IUPred-L |
66 |
76 |
| IUPred-S |
69 |
77 |
| PrDOS |
70 |
77 |
| Espritz-N |
74 |
78 |
| IUPred-S |
82 |
86 |
| IUPred-L |
82 |
85 |
| VLXT |
83 |
88 |
| PV2 |
88 |
89 |
| PV2 |
93 |
96 |
| PrDOS |
102 |
109 |
| VSL2b |
105 |
109 |
| PV2 |
105 |
109 |
| IUPred-S |
105 |
109 |
| Espritz-X |
105 |
109 |
| Espritz-N |
108 |
109 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| Thiamin diphosphate-binding fold (THDP-binding) |
52518 |
6.48e-21 |
Branched-chain alpha-keto acid dehydrogenase PP module |
88766 |
0.00000164 |
2-102 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Family |
CL0254 |
PF00676.15 |
E1_dh |
Dehydrogenase E1 component |
6.5e-27 |
94 |
1 |
81 |
| Pfam-B |
No Clan |
PB005502 |
|
|
0.000068 |
22.8 |
82 |
109 |
Post Translational Modification Sites
No weak SCOP hits found.