Sequence
3152700 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>3152700
MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| E7ET30 |
AK3 |
GTP:AMP phosphotransferase, mitochondrial |
Disordered Regions
75% of predictor's agree:
By predictor:
| Predictor |
Start |
End |
| VLXT |
1 |
6 |
| VSL2b |
1 |
6 |
| PrDOS |
1 |
9 |
| PV2 |
1 |
6 |
| IUPred-S |
1 |
6 |
| Espritz-N |
1 |
3 |
| Espritz-X |
1 |
6 |
| PV2 |
10 |
10 |
| VLXT |
11 |
20 |
| PV2 |
12 |
26 |
| Espritz-N |
15 |
21 |
| VSL2b |
16 |
26 |
| IUPred-L |
24 |
24 |
| VSL2b |
32 |
42 |
| PV2 |
32 |
42 |
| PV2 |
44 |
44 |
| IUPred-L |
53 |
54 |
| PV2 |
106 |
106 |
| VLXT |
107 |
132 |
| Espritz-N |
107 |
108 |
| PV2 |
110 |
144 |
| IUPred-L |
111 |
118 |
| IUPred-S |
113 |
122 |
| PrDOS |
116 |
119 |
| VSL2b |
118 |
134 |
| PrDOS |
121 |
123 |
| IUPred-L |
121 |
121 |
| IUPred-L |
124 |
124 |
| IUPred-L |
130 |
132 |
| VSL2b |
136 |
136 |
| Espritz-N |
158 |
161 |
| PrDOS |
175 |
187 |
| Espritz-X |
175 |
187 |
| Espritz-N |
176 |
187 |
| VLXT |
177 |
187 |
| PV2 |
177 |
187 |
| VSL2b |
178 |
187 |
| IUPred-S |
181 |
187 |
| IUPred-L |
182 |
187 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| Microbial and mitochondrial ADK, insert "zinc finger" domain |
57774 |
0.00000000000432 |
|
|
|
88-124 |
| P-loop containing nucleoside triphosphate hydrolases |
52540 |
1.88e-24 |
Nucleotide and nucleoside kinases |
52541 |
0.00000289 |
9-88,123-178 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
CL0023 |
PF00406.17 |
ADK |
Adenylate kinase |
0.0000000000094 |
45 |
12 |
50 |
| Domain |
CL0023 |
PF00406.17 |
ADK |
Adenylate kinase |
4.9e-18 |
65.4 |
49 |
152 |
| Domain |
No Clan |
PF05191.9 |
ADK_lid |
Adenylate kinase, active site lid |
1.8e-16 |
59.5 |
88 |
123 |
Post Translational Modification Sites
No weak SCOP hits found.