Results for 10727802

PNG SVG

Sequence

10727802 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>10727802
MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELADSDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIAQTLQEWCVGCEVVLSGIEEQVSRANLHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGEKINPQSSVKPSAK

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
F1MAA2 Cops7a Protein Cops7a

Disordered Regions

75% of predictor's agree:

Start End
3 4
226 277

By predictor:

Predictor Start End
VLXT 1 9
VSL2b 1 8
PrDOS 1 13
PV2 1 8
IUPred-S 1 6
Espritz-N 1 11
Espritz-X 1 7
IUPred-L 3 3
PV2 16 16
VLXT 44 45
VLXT 86 90
VSL2b 88 95
PV2 88 95
PrDOS 104 113
PV2 115 121
PV2 146 146
VSL2b 147 149
VLXT 186 202
VSL2b 192 277
PV2 192 277
PrDOS 194 277
Espritz-X 220 277
IUPred-L 224 277
Espritz-N 226 277
IUPred-S 227 277
VLXT 229 277
Espritz-D 230 277

SCOP Domain Regions

Hits with strong support:

No strong SCOP hits found.

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Family CL0123 PF01399.22 PCI PCI domain 0.0000000018 37.8 61 156

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 10727802


comments powered by Disqus