Results for 10727802
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>10727802
MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELADSDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIAQTLQEWCVGCEVVLSGIEEQVSRANLHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGEKINPQSSVKPSAK
UniProt Gene descriptions
UniProt | Gene Name | Gene Description |
---|---|---|
F1MAA2 | Cops7a | Protein Cops7a |
Disordered Regions
75% of predictor's agree:
Start | End |
---|---|
3 | 4 |
226 | 277 |
By predictor:
Predictor | Start | End |
---|---|---|
VLXT | 1 | 9 |
VSL2b | 1 | 8 |
PrDOS | 1 | 13 |
PV2 | 1 | 8 |
IUPred-S | 1 | 6 |
Espritz-N | 1 | 11 |
Espritz-X | 1 | 7 |
IUPred-L | 3 | 3 |
PV2 | 16 | 16 |
VLXT | 44 | 45 |
VLXT | 86 | 90 |
VSL2b | 88 | 95 |
PV2 | 88 | 95 |
PrDOS | 104 | 113 |
PV2 | 115 | 121 |
PV2 | 146 | 146 |
VSL2b | 147 | 149 |
VLXT | 186 | 202 |
VSL2b | 192 | 277 |
PV2 | 192 | 277 |
PrDOS | 194 | 277 |
Espritz-X | 220 | 277 |
IUPred-L | 224 | 277 |
Espritz-N | 226 | 277 |
IUPred-S | 227 | 277 |
VLXT | 229 | 277 |
Espritz-D | 230 | 277 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
Type | Clan | Family | Name | Description | E-value | Bitscore | Start | End |
---|---|---|---|---|---|---|---|---|
Family | CL0123 | PF01399.22 | PCI | PCI domain | 0.0000000018 | 37.8 | 61 | 156 |