Results for 10727038

PNG SVG

Sequence

10727038 is from the genome.

The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.

>10727038
MAECCVPVCQRPICIPPPYADLGKASRDICNNRFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALELEA

View in source genome browser

UniProt Gene descriptions

UniProt Gene Name Gene Description
F1LQJ3 Vdac2 Voltage-dependent anion-selective channel protein 2

Disordered Regions

75% of predictor's agree:

No agreed upon disordered regions found.

By predictor:

Predictor Start End
VSL2b 1 3
PrDOS 1 14
PV2 1 3
Espritz-N 1 3
Espritz-X 1 4
PV2 5 8
PV2 13 13
VSL2b 43 71
Espritz-X 49 70
Espritz-N 50 70
PV2 51 53
PV2 55 55
PV2 57 66
PrDOS 58 62
PV2 68 70
PV2 105 105
PV2 107 107
VSL2b 115 128
Espritz-N 116 126
PV2 120 128
VSL2b 171 177
PV2 193 194
PrDOS 225 227
VLXT 244 262
VSL2b 246 249
VSL2b 279 281
PV2 281 281
PV2 289 295
Espritz-X 289 295
VSL2b 290 295
IUPred-S 292 295
PrDOS 293 295
VLXT 295 295

SCOP Domain Regions

Hits with strong support:

No strong SCOP hits found.

Hits with weaker support:

No weak SCOP hits found.

Pfam Domain Regions

Type Clan Family Name Description E-value Bitscore Start End
Family No Clan PF01459.17 Porin_3 Eukaryotic porin 4.1e-75 252.6 15 288

Post Translational Modification Sites

No weak SCOP hits found.

Discussion about protein 10727038


comments powered by Disqus