Results for 10727038
Sequence
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>10727038
MAECCVPVCQRPICIPPPYADLGKASRDICNNRFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALELEA
UniProt Gene descriptions
UniProt | Gene Name | Gene Description |
---|---|---|
F1LQJ3 | Vdac2 | Voltage-dependent anion-selective channel protein 2 |
Disordered Regions
75% of predictor's agree:
No agreed upon disordered regions found.
By predictor:
Predictor | Start | End |
---|---|---|
VSL2b | 1 | 3 |
PrDOS | 1 | 14 |
PV2 | 1 | 3 |
Espritz-N | 1 | 3 |
Espritz-X | 1 | 4 |
PV2 | 5 | 8 |
PV2 | 13 | 13 |
VSL2b | 43 | 71 |
Espritz-X | 49 | 70 |
Espritz-N | 50 | 70 |
PV2 | 51 | 53 |
PV2 | 55 | 55 |
PV2 | 57 | 66 |
PrDOS | 58 | 62 |
PV2 | 68 | 70 |
PV2 | 105 | 105 |
PV2 | 107 | 107 |
VSL2b | 115 | 128 |
Espritz-N | 116 | 126 |
PV2 | 120 | 128 |
VSL2b | 171 | 177 |
PV2 | 193 | 194 |
PrDOS | 225 | 227 |
VLXT | 244 | 262 |
VSL2b | 246 | 249 |
VSL2b | 279 | 281 |
PV2 | 281 | 281 |
PV2 | 289 | 295 |
Espritz-X | 289 | 295 |
VSL2b | 290 | 295 |
IUPred-S | 292 | 295 |
PrDOS | 293 | 295 |
VLXT | 295 | 295 |
SCOP Domain Regions
Hits with strong support:
No strong SCOP hits found.
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
Type | Clan | Family | Name | Description | E-value | Bitscore | Start | End |
---|---|---|---|---|---|---|---|---|
Family | No Clan | PF01459.17 | Porin_3 | Eukaryotic porin | 4.1e-75 | 252.6 | 15 | 288 |