Sequence
10726921 is from the genome.
The highlighted portions of sequence are where there is 75% agreement between all disorder pedictors.
>10726921
GVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDEVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLAAGAESPQPASGNSPSEDDRSKSAPTSPCDQELKELENNIRKALSFDNRGEEHRASSSTDGQLASPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVAAQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPILTLVDEAIVKQINQEEFKGFSYFGEDLMP
View in source genome browser
UniProt Gene descriptions
| UniProt |
Gene Name |
Gene Description |
| F1LMV8 |
Prkce |
Protein kinase C epsilon type |
Disordered Regions
75% of predictor's agree:
| Start |
End |
| 41 |
42 |
| 119 |
167 |
| 172 |
208 |
By predictor:
| Predictor |
Start |
End |
| VSL2b |
1 |
5 |
| PrDOS |
1 |
7 |
| PV2 |
1 |
3 |
| IUPred-S |
1 |
2 |
| Espritz-N |
1 |
7 |
| Espritz-X |
1 |
7 |
| PrDOS |
31 |
47 |
| PV2 |
33 |
42 |
| VSL2b |
34 |
45 |
| Espritz-N |
36 |
45 |
| VLXT |
38 |
44 |
| IUPred-L |
40 |
44 |
| Espritz-N |
100 |
107 |
| PrDOS |
103 |
213 |
| PV2 |
110 |
110 |
| Espritz-N |
112 |
214 |
| Espritz-X |
112 |
212 |
| VSL2b |
118 |
211 |
| PV2 |
118 |
212 |
| IUPred-L |
118 |
166 |
| VLXT |
119 |
183 |
| IUPred-S |
122 |
208 |
| IUPred-L |
172 |
208 |
| VLXT |
185 |
209 |
| Espritz-N |
224 |
230 |
| Espritz-N |
237 |
239 |
| PV2 |
258 |
258 |
| VSL2b |
311 |
317 |
| VLXT |
412 |
425 |
| Espritz-N |
413 |
419 |
| VSL2b |
414 |
423 |
| PV2 |
414 |
427 |
| PrDOS |
461 |
468 |
| PV2 |
485 |
509 |
| VSL2b |
489 |
509 |
| VLXT |
490 |
507 |
| Espritz-N |
496 |
513 |
| PrDOS |
499 |
506 |
| IUPred-L |
505 |
505 |
| PV2 |
511 |
513 |
| PV2 |
515 |
517 |
| VLXT |
516 |
524 |
| PrDOS |
539 |
546 |
| Espritz-N |
540 |
546 |
| VSL2b |
541 |
546 |
| PV2 |
541 |
546 |
| IUPred-S |
541 |
546 |
| Espritz-X |
544 |
546 |
| VLXT |
545 |
546 |
SCOP Domain Regions
Hits with strong support:
| Superfamily Name |
SFam ID |
SFam E-value |
Family Name |
Fam ID |
Fam E-value |
Region |
| Cysteine-rich domain |
57889 |
0.00000872 |
|
|
|
2-30 |
| Protein kinase-like (PK-like) |
56112 |
5.4e-93 |
Protein kinases, catalytic subunit |
88854 |
0.0000000104 |
214-524 |
| Cysteine-rich domain |
57889 |
4.93e-21 |
|
|
|
45-104 |
Hits with weaker support:
No weak SCOP hits found.
Pfam Domain Regions
| Type |
Clan |
Family |
Name |
Description |
E-value |
Bitscore |
Start |
End |
| Domain |
CL0006 |
PF00130.17 |
C1_1 |
Phorbol esters/diacylglycerol binding domain (C1 domain) |
0.0000000000000011 |
57 |
52 |
104 |
| Domain |
CL0016 |
PF00069.20 |
Pkinase |
Protein kinase domain |
3.8e-67 |
226.1 |
217 |
477 |
| Pfam-B |
No Clan |
PB004186 |
|
|
1.4e-16 |
60.8 |
411 |
536 |
| Family |
No Clan |
PF00433.19 |
Pkinase_C |
Protein kinase C terminal domain |
0.000000016 |
34.9 |
497 |
543 |
Post Translational Modification Sites
No weak SCOP hits found.